PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G240800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 478aa    MW: 51175 Da    PI: 7.211
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G240800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.3e-11329387563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +a l +++
  Sevir.6G240800.1.p 329 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSAGLATQN 387
                         899*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-18325389IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852327390IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12329380No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-11329386No hitNo description
PfamPF001701.7E-9329387IPR004827Basic-leucine zipper domain
CDDcd147032.73E-23330381No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDDSGAADPG AARHHLSPQL GGQQPQPPVP RSPTPLDLAS AAAAASGYRR LSPSLRPPAH  60
PQARLPSPYG QIPAPGGGGH HARSLSQPLF FSLDSLPPPP YADLGAAAHA VPPSPPSSSS  120
DPHPPPPPPL GLPPRKGGHR RSHSDIPFGG FAQLSPPLPP PAPVKREVTI AAEGCRSDGG  180
DDAALYDLVN AYMDLDGLDP LNSSEDRHDD RDSRASGTRA GSAAESSENE AESQSTSVDR  240
KDGGKSRHCR SLSMDSFMGK LNFAAGDESP KLPLPSPGGS LTRSGSGSLE GGAVALFDME  300
FANGEFTESE KKKIMANERL AEIALTDPKR VKRILANRQS AARSKERKMR YIQELEHKVQ  360
VLQTEATTLS AQLTMLQRDS AGLATQNNEL KIRLQAMEQQ AQLRDALNEA LTGEVQRLKL  420
ATGEISDGRM PKSLQQQMNS QMLQLQQLQI QQQQQQQQAP QTQQQQQQHQ QQPQKSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9558090.0EU955809.1 Zea mays clone 1547185 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147562.10.0uncharacterized protein LOC100281171
TrEMBLK3YNI10.0K3YNI1_SETIT; Uncharacterized protein
STRINGSi015823m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-74bZIP family protein